I need help this makes no sense

I Need Help This Makes No Sense

Answers

Answer 1

Answer:

∠ SQT = 63°

Step-by-step explanation:

since QS bisects ∠ RQT , then

∠ RQS = ∠ SQT = 7x + 7

then

∠ RQS + ∠ SQT = ∠ RQT , that is

7x + 7 + 7x + 7 = 9x + 54

14x + 14 = 9x + 54 ( subtract 9x from both sides )

5x + 14 = 54 ( subtract 14 from both sides )

5x = 40 ( divide both sides by 5 )

x = 8

Then

∠ SQT = 7x + 7 = 7(8) + 7 = 56 + 7 = 63°


Related Questions

solve for x.

please help with this problem i am really bad at geometry!! will give thanks

Answers

Answer:

[tex]x = 11[/tex]

Step-by-step explanation:

[tex] \frac{12x + 8 - 4x + 4}{2} = 50[/tex]

[tex] \frac{8x + 12}{2} = 50[/tex]

[tex]8x + 12 = 100[/tex]

[tex]8x = 88[/tex]

[tex]x = 11[/tex]

What are m∠1 and m∠2?

A. ∠1 = 30°, m∠2 = 35°
B. ∠1 = 35°, m∠2 = 30°
C. ∠1 = 65°, m∠2 = 60°
D. ∠1 = 85°, m∠2 = 80°

Answers

The measure of m∠1 = 85 degrees and m∠2 = 15 degrees.

The correct answer is option D: ∠1 = 85°, m∠2 = 15°.

What is the right triangle?

A right-angle triangle is a triangle that has one of its angles 90 degrees. The sum of angles in a right triangle is 180 degrees.

To find the measures of angles 1 and 2, we can use the fact that the sum of the angles in a triangle is 180 degrees.

We know that angles 1, 2, and 3 form a triangle, so we can write:

m∠1 + m∠2 + m∠3 = 180

Substituting the given values, we get:

m∠1 + m∠2 + 80 = 180

Simplifying, we get:

m∠1 + m∠2 = 100

We also know that angles 2, 3, and 4 form a triangle, so we can write:

m∠2 + m∠3 + m∠4 = 180

Substituting the given values, we get:

m∠2 + 80 + 85 = 180

Simplifying, we get:

m∠2 = 15

Substituting this value in the first equation, we get:

m∠1 + 15 = 100

Simplifying, we get:

m∠1 = 85

Therefore, the measure of m∠1 = 85 degrees and m∠2 = 15 degrees.

The correct answer is option D: ∠1 = 85°, m∠2 = 15°.

To learn more about the right triangle visit:

https://brainly.com/question/29869536

#SPJ1

Answer:

Step-by-step explanation:

The measure of m∠1 = 85 degrees and m∠2 = 15 degrees.

The correct answer is option D: ∠1 = 85°, m∠2 = 15°.

What is the right triangle?

A right-angle triangle is a triangle that has one of its angles 90 degrees. The sum of angles in a right triangle is 180 degrees.

To find the measures of angles 1 and 2, we can use the fact that the sum of the angles in a triangle is 180 degrees.

We know that angles 1, 2, and 3 form a triangle, so we can write:

m∠1 + m∠2 + m∠3 = 180

Substituting the given values, we get:

m∠1 + m∠2 + 80 = 180

Simplifying, we get:

m∠1 + m∠2 = 100

We also know that angles 2, 3, and 4 form a triangle, so we can write:

m∠2 + m∠3 + m∠4 = 180

Substituting the given values, we get:

m∠2 + 80 + 85 = 180

Simplifying, we get:

m∠2 = 15

Substituting this value in the first equation, we get:

m∠1 + 15 = 100

Simplifying, we get:

m∠1 = 85

Therefore, the measure of m∠1 = 85 degrees and m∠2 = 15 degrees.

The correct answer is option D: ∠1 = 85°, m∠2 = 15°.

To learn more about the right triangle visit:

brainly.com/question/29869536

#SPJ1

Which line L has a slope of zero?

Answers

I think D because
It is horizontal and therefore the slope is zero

Answer:

D

Step-by-step explanation:

Gradient

A Gradient is also called a slope of a line, which represents how steep a line is.

Formula of slope: Vertical difference ÷ Horizontal difference

For a slope to be zero, the line must be horizontal.

Solution

Based on the question given, we can deduce that D is a horizontal line and therefore the slope is zero.

Type the correct answer in each box. Use numerals instead of words. Find the missing side and angle measures in triangle ABC. Round your answers to the nearest tenth. Scalene triangle ABC with side AC labeled 23 and side BC labeled 15. Angle A measures 40 degrees. The measure of angle B is approximately . The measure of angle C is approximately . The length of side AB is approximately

Answers

The measures of the angles of the triangles are

The measure of ∠B = 80.3°

The measure of ∠C = 59.7°

The length of side AB = 20.2 units

What is a Triangle?

A triangle is a plane figure or polygon with three sides and three angles.

A Triangle has three vertices and the sum of the interior angles add up to 180°

Let the Triangle be ΔABC , such that

∠A + ∠B + ∠C = 180°

The area of the triangle = ( 1/2 ) x Length x Base

For a right angle triangle

From the Pythagoras Theorem , The hypotenuse² = base² + height²

if a² + b² = c² , it is a right triangle

if a² + b² < c² , it is an obtuse triangle

if a² + b² > c² , it is an acute triangle

Given data ,

Let the triangle be represented as ΔABC

Now , the measure of side AC = 23

The measure of side BC = 15

The measure of ∠A = 40°

From the law of sines , we get

( sin A ) / a = ( sin B ) / b = ( sin C ) / c

Substitute the value of A and a in the equation , we get

sin ( 40 )° / 15 = sin B / 23

On simplifying the equation , we get

sin B = ( 23/15 ) x sin ( 40 )°

Now , m∠B = 80.27°

So , the measure of angle ∠B = 80.3°

And ,

The interior angles of a triangle is 180°

So , The measure of angle ∠C = 180° - ( 80.3° + 40° )

On simplifying the equation , we get

The measure of angle ∠C = 59.7°

Now ,

From the law of cosines , c² = a² + b² - 2ab ( cos C )

Substitute the value of a , b and cos C in the equation , we get

c² = 15² + 23² - 2 ( 15 ) ( 23 ) cos ( 59.7 )°

On simplifying the equation , we get

c² = 225 + 529 - 348.12363

c² = 405.87

Taking square roots on both sides of the equation , we get

c = 20.156

c = 20.2 units

Therefore, the measure of side AB = 20.2 units

Hence , the measures angles of triangle is solved

To learn more about triangles click :

https://brainly.com/question/16739377

#SPJ1

Choose the type of variation that relates the variables in the table.

Answers

Answer:

Multiply the x by 5 to get the y

find three fifth of Ghana cedis 200


Answers

Answer:

Hi.

three fifth of 200 is 120.

Steve, a restaurant owner, pays $2.75 per
pound for organic lettuce. He also pays
$50 for the lettuce to be delivered to his
restaurant. About how many pounds of
lettuce can Steve purchase &nd have
delivered for $220?

Answers

Answer: About 62 pounds of organic lettuce

2.75x+50=220

Solve for x

x=61.81(repeating)

Find the volume of each solid. Round to the nearest tenth if necessary. Use 3.14 for or
22/7
A : 14.7 m3
B : 3.7 m3
C : 4.7 m
D : 6.7 m3

Answers

Answer:

1.1^2 = 1.21

1.21 x 3.14 = 3.7994

3.7994 x 2.9 = 11.01826

11.01826 divided by 3 = 3.67275333333 rounded = 3.7 m3

If both pairs of opposite sides of a quadrilateral are congruent, then the quadrilateral is a Question 18 options: A) kite. B) trapezoid. C) hexagon. D) parallelogram.

Answers

If both pairs of opposite sides of a quadrilateral are congruent, then the quadrilateral is a parallelogram.

Option (d) is the correct choice.

A parallelogram is a straightforward quadrilateral with two sets of parallel sides in Euclidean geometry. A parallelogram's facing or opposing sides are of equal length, and its opposing angles are of similar size.

A parallelogram has the following qualities:

The opposing sides are equally spaced and parallel.

Angles on either side are equal.

The following or neighboring angles are supplemental.

All of the angles will be at right angles if any one of them is a right angle.

The two diagonals cut across one another.

For more questions on Parallelogram

https://brainly.com/question/3050890

#SPJ4

HELP DUE IN 10 MINS!

Find the value of x and y in the kite below.

x=?? degrees

y=?? degrees

Answers

Answer:

Diagonals of a kite are perpendicular.

x = 90° - 58° = 32°y = 90° - 22° = 68°

Kim paid $33 for 2 shirts and $48 for 3 shirts including a fixed shipping fee assuming the same function applies to any numbers of shirts bought how much in dollars would 1 shirt cost before the shipping fee

Answers

Answer:

33=2x+y, 48=3x+y

Step-by-step explanation:

Sorry my internet isn't working well. Go to math-way and put that in and it will give you the answer :)

Use the distributive property to simplify the expression
6(8x+5)

Answers

Answer: 48x+30

Step-by-step explanation:

6(8x+5)

Use the distributive property to multiply 6 by 8x+5.

48x+30

Hope it Helps!

When Juan commutes to work, the amount of time it takes him to arrive is normally distributed with a mean of 31 minutes and a standard deviation of 4.5 minutes. Using the empirical rule, what percentage of his commutes will be between 22 and 40 minutes?

Answers

Answer: 95%

Step-by-step explanation:

i kinda slayed

Using the empirical rule, for normal distribution is 68 % of his commutes will be between 23.5 and 32.5 minutes

What is normal distribution?

The normal distribution is a probability distribution used to calculate probability for continuous variables.

Here, we have,

to find what percentage of his commutes will be between 23.5 and 32.5 minutes using the empirical rule:

Now, since gabriel commutes to work, the amount of time it takes him to arrive is normally distributed with a mean of 28 minutes and a standard deviation of 4.5 minutes, we need to find the percentage of his commutes will be between 23.5 and 32.5 minutes using the empirical rule.

First, we need to find how many standard deviations away from the mean each value is using the z-score

Z = (x - μ)/σ where

x = value,

μ = mean and

σ = standard devation

For x = 23.5, we have

Z = (x - μ)/σ

Z = (23.5 - 28)/4.5

Z = -4.5/4.5

Z = -1

Z = -1σ

Also, for x = 32.5, we have

Z = (x - μ)/σ

Z = (32.5 - 28)/4.5

Z = 4.5/4.5

Z = 1

Z = 1σ

So, we have that -1σ ≤ (x - μ) ≤ 1σ

So, the values between 23.5 and 32.5 minutes lie within one standard deviation.

Using the empirical rule, this is 68 % of the values.

So, 68 % of his commutes will be between 23.5 and 32.5 minutes

Learn more about empirical rule for normal distribution here:

brainly.com/question/28873888

#SPJ2

complete question:

when gabriel commutes to work, the amount of time it takes him to arrive is normally distributed with a mean of 28 minutes and a standard deviation of 4.5 minutes. using the empirical rule, what percentage of his commutes will be between 23.5 and 32.5 minutes?

A can of carrots weighs 15/16 of a pound. One serving of carrots is ¼ of a pound. How many servings are in the can of carrots?

Answers

Answer:

Step-by-step explanation:

How many carrots are in a can?  is that the question ?  :DDDDD

15/16   and  1/4 = 4/16 sooo

4*3 = 12

so three full servings  and one that is  3/4 full  

so 3

Which statement correctly describes this picture?

Answers

Answer is option D.

Because there, TY is show as a ray with one end point only. And PR is a lone segment.

A car on a Ferris wheel with a radius of 20 feet. To the nearest foot, how far does the car travel over an angle of pi/3 radians? (Include the unit of measure in your response.)

Answers

Answer:21

Step-by-step explanation:

The car on a Ferris wheel with a radius of 20 feet. travels a distance of 125.6 feet

In order to determine the distance that the car has travelled, we will use the formula for calculating the circumference of a circle expressed as:

C = 2πr

r is the radius of the fairy wheel

Given the following parameters

radius = 20 feet

Substitute into the formula of the circumference:

[tex]C = 2(3.14)(20)\\C = 40(3.14)\\C = 125.6 feet[/tex]

This shows that the car on a Ferris wheel with a radius of 20 feet. travels a distance of 125.6 feet

Learn more here: https://brainly.com/question/23242098

The annual gym subscription for a single member is Rs.1000, while an annual family membership is Rs.1500. The gym is considering increasing all membership fees by the same amount. If this is done then a single membership would cost 5/7 of a family membership. Determine the amount of the proposed increase.

Answers

The amount of the proposed increase is, Rs 1071.4

What is Division method?

Division method is used to distributing a group of things into equal parts. Division is just opposite of multiplications. For example, dividing 20 by 2 means splitting 20 into 2 equal groups of 10.

Given that;

The annual gym subscription for a single member is Rs.1000,

And, An annual family membership is Rs.1500.

Here, A single membership increased cost 5/7 of a family membership.

Hence, The increased cost = 5/7 of 1500

                                          = 1071.4 Rupees

Learn more about the divide visit:

https://brainly.com/question/28119824

#SPJ1

How do you describe a logarithmic function?

Answers

A logarithmic function is a type of inverse function.

A logarithmic function is a type of inverse function that is commonly used in mathematics and science. It is typically written in the form of y = log base b (x), where b is the base of the logarithm, and x is the input value. The most common bases for logarithms are 10 (common logarithm) and e (natural logarithm).

The logarithmic function is the inverse of the exponential function with base b. This means that if y = log base b (x) then x = b^y

One way to describe a logarithmic function is to say that it represents the exponent to which the base number must be raised in order to produce the input value x. For example, log base 10 of 100 is 2, because 10^2 = 100.

Another way to describe a logarithmic function is to say that it is a way of expressing very large or small numbers in a more manageable form. For example, instead of expressing a number like 10^9 as 1 billion, it can be expressed as 9 using a logarithm to base 10.

It is also important to note that logarithmic function have some key characteristics such as:

The domain of a logarithmic function is x>0, since the logarithm of a non-positive number is undefined.

The range of a logarithmic function is all real numbers.

The graph of a logarithmic function has a vertical asymptote at x=0, since the logarithm of a non-positive number is undefined.

A logarithmic function is increasing over its domain and concave down.

The x-intercept of the graph is (1,0), since the logarithm of 1 is always 0.

Overall, logarithmic functions are mathematical tools that allow us to simplify the representation and manipulation of very large and small numbers, and are used in many areas of science and engineering.

To learn more about logarithms visit: brainly.com/question/30085872

#SPJ4

Which equation is the slope intercept form of this equation?
y - 4 = -2 (x – 5)
a- x = - 2y + 3
b- 2x + y = 6
c- y = -2x + 14
d- y – 4 = -2x + 10

Answers

Answer:

C

Step-by-step explanation:

Y - 4 = -2x + 10 Multiply -2 to the inside the brackets

Y = -2x + 14 Add the 4 over

value of the 7 in the number 8765?

PLEASE HELP!

Answers

Answer:

the answer would be seven hundred

8,000

700

60

5

hope this helps :)

The value of 7 in the number represents 100th place.

What is a place value system?

The mathematical expression is the combination of numerical variables and operations denoted by addition, subtraction, multiplication, and division signs.

The precise position of a number within a series is assigned a value by a place-value system.

The given number is 8765 in the number 7 is representing 100th place. The expanded form of the number can be written as:-

8765 = 8000 + 700 + 60 + 5

Here in the expanded form, it is observed that 7 is the 100th place of the number.

Therefore, the value of 7 in the number represents the 100th place.

To know more about the place value system follow

brainly.com/question/2004114

#SPJ2

Decide whether the rates are equivalent.
$16 for 4 pounds
$1 for 4 ounces
O Equivalent
O Not equivalent

Answers

Yes, the rates are equivalent
The rates are equivalent because 1 pound is 16 ounces, therefore 4 pounds are 64 ounces, this means that the value of 64 ounces is $16, now we should divide both (64 and 16) by 16 which will give us a value of $1 for every 4 ounces.

Fill in the blank: If a number is located to the left
of another number on the number line, that
number is ____ the other number

Answers

Answer:

smaller/ less than

Answer:

less than

Step-by-step explanation:

On a number line, the values go from least to greatest, left to right. So if you go towards the left, the number is decreasing.

how to solve x-y+x/2 (if x=10, y=1)

Answers

it’s 14, (i think) bc you do 10-1+10/2
=14 bc 10-1=9 and 10/2 = 5 so 5+4 =9

Anyone know this? I’m a wee bit brain dead any help is appreciated

Answers

The number that goes in the box is 2 (B).

I hope this helps :)

Answer:

I believe this is the only answer I got from you bro.

hope it helps.

(52 − 3 − 8)− (− 82 − 9 + 12)

Answers

120 woooooooooooooooooo

How do you solve this?.....Katherine has a loyalty card good for a 3% discount at her local grocery store. What number should she multiply the prices on the tags by to find the price she would have to pay, before tax, in one step?

Answers

Answer:

Step-by-step explanation:

To find the number Katherine should multiply the prices on the tags by to find the price she would have to pay before tax, we need to calculate the inverse of the discount percentage, which is 1 - (discount percentage / 100).

Given that the discount is 3% and we want to find the price after the discount, that means:

1 - (3/100) = 1 - 0.03 = 0.97

So, the number Katherine should multiply the prices on the tags by to find the price she would have to pay, before tax, in one step, is 0.97. Multiplying the price of an item by 0.97 is equivalent to subtracting 3% from the original price, which is the same as finding the final price after the discount.

For example, if an item is priced at $10, Katherine can multiply this by 0.97 to find that the final price she would have to pay before tax is $9.7

10*0.97 = 9.7

*HELP PLEASE*
In circle J with HJK = 146", find the HLK.

A) 214°
B) 73°
C) 292°
D) 46.5°

Answers

Answer:

B. 73°

Step-by-step explanation:

Yessssssssssssssssssssssssssssssssssssssssssssss

Jackson used all the butter to make the brownies. If each brownie is 19 1 9 of a batch, how many brownies did he make? Enter your answer in the box.

Answers

Answer:

9 brownies

Step-by-step explanation:

Since we are not given the total number of batches. Let us assume the total batches is 81

If each brownie is 1/9 of a batch, number of brownie made will be equivalent to:

Amount of brownie made = 1/9 × 81

Amount of brownie made = 81/9 = 9 brownies

Hence he made 9 brownies

__________ are designed so that the objective of the test is not apparent to the test taker. A. Projective tests B. Source errors C. MMPI tests D. 16PF tests Please select the best answer from the choices provided A B C D

Answers

Projective tests are created so that the test taker cannot tell what they are testing for.

What is Projective tests?Projective tests are created so that the test taker cannot tell what they are testing for.A personality test used in psychology is called a projective test. This kind of test provides answers to confusing situations, phrases, or visuals. Unconscious motivations or attitudes are disclosed by asking the person a question or giving them a stimulus that is unclear. Projective exams are designed to enlighten individuals about sentiments, wants, and conflicts that are not readily apparent to them. Psychoanalysts try to find unconscious feelings that might be behind a person's troubles in life by evaluating responses to ambiguous stimuli. Projective testing is mostly used to evaluate personality functioning.

To learn more about Projective tests refer to:

https://brainly.com/question/20221937

#SPJ4

Rudy says that the sum of the measures of the exterior angles of a regular hexagon is 720°. Is Rudy correct? Why or why not?

Answers

Answer:

Yes, Rudy is correct

Explanation:

Number of sides of a hexagon = 6

The sum of all interior angles of a polygon with n sides  = (n-2)*180

Here, since a regular hexagon has 6 sides, n = 6

= (6 - 2)*180

= 4*180

= 720 degrees

Hope it helps :)

Have a great day!

720 is most likely the answer
Other Questions
Which of the following statements accurately describes President Hayess reaction to the Great Railroad Strike of 1877?President Hayes ordered railroad companies and striking workers to resolve their dispute through peaceful negotiations.President Hayes ordered railroad companies to reverse pay cuts to end the strike.President Hayes promised railroad workers government subsidies as incentives to return to work.President Hayes sent militias and federal troops from town to end the strike. Which three sentences use a reflexive pronoun correctly? Shippers Warehouse initiates a suit against Trans-State Trucking (TST) by filing a complaint. If TST files a motion to dismiss, the firm is asserting that Group of answer choices even if the facts in the complaint are true, TST is not legally liable. the facts in the complaint are not true. even if TST is legally liable, Shippers Warehouse cannot prove it. if the facts are true, Shippers Warehouse has a right to judicial relief. I am asking a qeustion so I can aswer some Are the two triangles similar? Why or why not? What is body mass index and what is it used for ? Identify the infinitive phrase in the following sentence.The new student was the first one to volunteer for the newly formed photography club.Group of answer choicesphotography clubwas the firstnewly formedto volunteer How might confirmation bias affect our ability to judge the accuracy of information found online? what is a difference between mass and volume 87.5 - 23.4 *O 64.1O 110.9054.1 What is the theoretical probability that an even number will be rolled on a number cube? I dont understand and also any fake answers will be reported The US policy against the spread of communism was called The Truman Doctrine. True or False How could the matter in a piece of rock at the top of a mountain eventually be incorporated into volcanic lava? Write a short essay showing how the atmosphere, hydrosphere, cryosphere, geosphere, and biosphere are involved in this process. Put the continuum of force in order from least to greatest force: A. Verbal Officer + Presence + Lethal + Empty Hand + Less LethalB. Less Lethal + Empty Hand + Lethal + Verbal + Officer PresenceC. Officer Presence + Verbal + Empty Hand + Less Lethal + Lethal what is 9.5 is what % of 50 i have a test tomorrow 1/11/23 and I dont understand it PPPLSSSSSS HELPPPPPP ILL GIVE BRAINLYEST Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom The lesson of the story is Never giveup!" What else might the author add tothe lesson of the story? Find the lope-intercept equation of the line that pae through (1,-3) and ha a lope of -1/4 What is the main idea of Geographical Landforms ?